PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000213555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 528aa    MW: 60428.4 Da    PI: 6.3801
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000213555genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM35.33.4e-11848242
            NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv 42
                   p+G++FhP+deelv +yL++kv+g +++ e+vi+++d+y +
  MDP0000213555  8 PVGYKFHPKDEELVGYYLHNKVRGVPFKDENVIPDIDLYGS 48
                   89***************************99******9964 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-10447IPR003441NAC domain
PfamPF023656.5E-6837IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MASANDFPVG YKFHPKDEEL VGYYLHNKVR GVPFKDENVI PDIDLYGSIE VRDIWNNNGG  60
ENLGKVKTFT SLPNLNQRAG RIRKNYDRKR KADDREETKV VESQRKKIQR KFENIDESYV  120
TPVSSEVAED VNTNHYPQQQ KPQQEQQTNL QHNGFVNNVD HCYNQQQQEH LSMANQQDYL  180
QHDGFVNNET DLPQYDYSST QDPSSGTVFS HYDLPQTATT GFANQPYHIV TQDQPNYFFA  240
DPTMASSVRM ASQEDYLQHD GSVNNVTDLP QHHYSNAQPS SGTVLSHYDP PQTDTTGFAN  300
QPHHFVTQDQ LRMRMLFQIS IFYGSMEARD IWNNNGGQNL GKGEDLYFFT KLKPTSNKVT  360
GSRVARTIGS GTWHGQNSGT KVKDPKTKET KVGGKGLHMR ILNILKKTVV GLCTSLAWTL  420
NWPFCRIRKN YDRRRNADDH EETKVAEDVN TNHYPQQQKP QQEQQTNLQP NGFVNNVDRC  480
YNQQQQENYN VTDFPQCYYD SQEPMARPDD CIAEAACPTL ASSLGMAN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009357365.11e-126PREDICTED: NAC transcription factor 29-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55724133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62380.17e-09NAC-domain protein 101